Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carnosine Dipeptidase 1/CNDP1 (C-6His)

Source: Human Cells. MW :54.9kD. Recombinant Human Carnosine Dipeptidase 1 is produced by our Mammalian expression system and the target gene encoding Pro28-His507 is expressed with a 6His tag at the C-terminus. Carnosine Dipeptidase 1 (CNDP1) belongs to the M20 metalloprotease family. CNDP1 is specifically expressed in the brain, serum and adult nervous central system. It is identified as human carnosinase. CNDP1 contains trinucleotide (CTG) repeat length polymorphism in the coding region and is inhibited by the metal chelator 1,10-o-phenantrolin. In addition, CNDP1 can hydrolyse the beta-Ala|-His dipeptide (carnosine), anserine, Xaa-|-His dipeptides and other dipeptides including homocarnosine. CNDP1 deficiency has been associated with homocarnosinosis disease.

Product Specifications

Gene Name

CNDP1

Gene ID

84735

UniProt

Q96KN2

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Polyclonal TULP2 Antibody
H00007288-B01P 0.05 mg

Mouse Polyclonal TULP2 Antibody

Ask
View Details
TIP30 (HTATIP2) Human shRNA Plasmid Kit (Locus ID 10553)
TL312293 1 Kit

TIP30 (HTATIP2) Human shRNA Plasmid Kit (Locus ID 10553)

Ask
View Details
SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid symporter), Member 2, FLJ16051, MGC119658, MGC119660, PAT2, TRAMD1) (HRP)
251749-HRP 100 µL

SLC36A2 (Solute Carrier Family 36 (Proton/amino Acid symporter), Member 2, FLJ16051, MGC119658, MGC119660, PAT2, TRAMD1) (HRP)

Ask
View Details
Recombinant Chemokine C-C-Motif Receptor 7 (CCR7)
SIPB838Mu02-01 10 µg

Recombinant Chemokine C-C-Motif Receptor 7 (CCR7)

Ask
View Details
Recombinant Chemokine C-C-Motif Receptor 7 (CCR7)
SIPB838Mu02-02 50 µg

Recombinant Chemokine C-C-Motif Receptor 7 (CCR7)

Ask
View Details
Recombinant Chemokine C-C-Motif Receptor 7 (CCR7)
SIPB838Mu02-03 200 µg

Recombinant Chemokine C-C-Motif Receptor 7 (CCR7)

Ask
View Details