Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell Adhesion Molecule 3/CADM3/IGSF4B/SynCAM3 (C-6His)

Source: Human Cells. MW :34.68kD. Recombinant Human Cell Adhesion Molecule 3 is produced by our Mammalian expression system and the target gene encoding Asn25-His330 is expressed with a 6His tag at the C-terminus. Cell Adhesion Molecular Proteins are proteins located on the cell surface involved with the binding with other cells or with the extracellular matrix in the cell adhesion process. These proteins consists of three domains, an transmembrane domain, an intracellular domain that interacts with the cytoskeleton, and an extracellular domain that interacts with other CAMs of the same kind or with other CAMs or the extracellular matrix. Cell Adhesion Molecular 3 (CADM3) is a neural tissue-specific member of the nectin-like family of immunoglobulin superfamily. CADM3 interacts with EPB41L1 may regulate structure or function of cell-cell junctions. CADM3 has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3.

Product Specifications

Gene Name

CADM3

Gene ID

57863

UniProt

Q8N126

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD69 Antibody
MBS9509282-01 0.05 mL

CD69 Antibody

Ask
View Details
CD69 Antibody
MBS9509282-02 0.1 mL

CD69 Antibody

Ask
View Details
CD69 Antibody
MBS9509282-03 5x 0.1 mL

CD69 Antibody

Ask
View Details
Human PAX5 qPCR Primer Pair
QH04561S 200 Tests

Human PAX5 qPCR Primer Pair

Ask
View Details
Recombinant Mouse Sodium channel subunit beta-3 (Scn3b), partial
MBS1343456-01 0.5 mg (E-Coli)

Recombinant Mouse Sodium channel subunit beta-3 (Scn3b), partial

Ask
View Details
Recombinant Mouse Sodium channel subunit beta-3 (Scn3b), partial
MBS1343456-02 0.05 mg (Baculovirus)

Recombinant Mouse Sodium channel subunit beta-3 (Scn3b), partial

Ask
View Details