Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Azurocidin/CAP37/HBP (C-6His)

Source: Human Cells. MW :25.24kD. Recombinant Human Azurocidin is produced by our Mammalian expression system and the target gene encoding Ile27-Pro250 is expressed with a 6His tag at the C-terminus. Azurocidin is an Azurophil granule antibiotic protein, with monocyte chemotactic and antibacterial activity. The Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. Azurocidin is a member of the serine protease family that includes Cathepsin G, Neutrophil Elastase (NE), and Proteinase 3 (PR3), however, Azurocidin is not a serine proteinase since the active site serine and histidine residues are replaced. Human Azurocidin together with NE and PR3 are expressed coordinately and are packaged together into azurophil granules during neutrophil differentiation. Azurocidin has been identified as a modulator of endothelial permeability and an important multifunctional inflammatory mediator. Neutrophils arriving first at sites of inflammation release Azurocidin which acts in a paracrine fashion on endothelial cells causing the development of intercellular gaps and allowing leukocyte extravasation. Azurocidin thus be regarded as a reasonable therapeutic target for a variety of inflammatory disease conditions.

Product Specifications

Gene Name

AZU1

Gene ID

566

UniProt

P20160

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) (MaxLight 750) discontinued
125296-ML750 100 µL

CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) (MaxLight 750) discontinued

Ask
View Details
Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7203697-01 48 Well

Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Ask
View Details
Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7203697-02 96 Well

Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Ask
View Details
Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7203697-03 5x 96 Well

Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Ask
View Details
Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7203697-04 10x 96 Well

Chicken C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Ask
View Details
Chicken Chemokine C-C motif ligand 8 ELISA Kit
MBS755491-01 48 Well

Chicken Chemokine C-C motif ligand 8 ELISA Kit

Ask
View Details