Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fetuin-A/AHSG/a-2-HS-Glycoprotein/AHSG (C-6His)

Source: Human Cells. MW :38.36kD. Recombinant Human Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Val367 is expressed with a 6His tag at the C-terminus. a-2-HS Glycoprotein (AHSG) is a glycoprotein that is composed of two subunits, the A and B chains, belongs to the Cystatin family of proteases inhibitors. It is highly expressed in embryonic cells and adult hepatocytes, and is expressed to a lesser extent in monocytes/macrophages. AHSG is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. In addition, AHSG may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages. ASHG blocks TGF-beta-dependent signaling in osteoblastic cells.

Product Specifications

Gene Name

AHSG

Gene ID

197

UniProt

P02765

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)
MBS1004796-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)

Ask
View Details
Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)
MBS1004796-02 0.02 mg (Yeast)

Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)

Ask
View Details
Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)
MBS1004796-03 0.1 mg (E-Coli)

Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)

Ask
View Details
Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)
MBS1004796-04 0.1 mg (Yeast)

Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)

Ask
View Details
Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)
MBS1004796-05 0.02 mg (Baculovirus)

Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)

Ask
View Details
Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)
MBS1004796-06 0.02 mg (Mammalian-Cell)

Recombinant Xenopus laevis LIM/homeobox protein Lhx3 (lhx3)

Ask
View Details