Recombinant Human AGER/RAGE (C-6His)

Source: Human Cells. MW :35.2kD. Recombinant Human AGER is produced by our Mammalian expression system and the target gene encoding Ala23-Ala344 is expressed with a 6His tag at the C-terminus. Advanced Glycosylation End Product-Specific Receptor (AGER) belongs to the immunoglobulin superfamily of cell surface molecules. It lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Besides AGEs, AGER is also able to bind other ligands which is thought to result in pro-inflammatory gene activation. It is known that AGER serve as a mediator of both acute and chronic vascular inflammation in certain conditions such as atherosclerosis and in particular as a complication of diabetes. Furthermore, it plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes.

Product Specifications

Gene Name

AGER

Gene ID

177

UniProt

Q15109

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAVDHHHHHH