What is the catalog number for Recombinant Human M-CSF/CSF1 (C-6His)?

The catalog number for Recombinant Human M-CSF/CSF1 (C-6His) is 32-7374-50.

What sizes are available for Recombinant Human M-CSF/CSF1 (C-6His)?

Recombinant Human M-CSF/CSF1 (C-6His) is available in the following size(s): 50 µg.

Is Recombinant Human M-CSF/CSF1 (C-6His) in stock?

Recombinant Human M-CSF/CSF1 (C-6His) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human M-CSF/CSF1 (C-6His)

Source: Human Cells. MW :26.17kD. Recombinant Human Macrophage Colony-Stimulating Factor is produced by our Mammalian expression system and the target gene encoding Glu33-Arg255 is expressed with a 6His tag at the C-terminus. Granulocyte/Macrophage Colony-Stimulating Factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and themonocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy.

Product Specifications

Gene Name

CSF1

Gene ID

1435

UniProt

P09603

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRVDHHHHHH