Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 5/KLK5 (C-6His)

Source: Human Cells. MW :30.65kD. Recombinant Human Kallikrein 5 is produced by our Mammalian expression system and the target gene encoding Val23-Ser293 is expressed with a 6His tag at the C-terminus. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen Kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.

Product Specifications

Gene Name

KLK5

Gene ID

25818

UniProt

Q9Y337

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANSVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHD Rabbit Polyclonal Antibody
TA369187 100 µL

LDHD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HOXC10 Antibody [Janelia Fluor 646]
NBP1-71932JF646 0.1 mL

Rabbit Polyclonal HOXC10 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Rabbit Polyclonal c-Maf Antibody
NBP1-88072-25ul 25 µL

Rabbit Polyclonal c-Maf Antibody

Sign In for Pricing
View Details
Human IgG4 Isotype Control S228P/R409K
ICH2257SPRK-50mg 50 mg

Human IgG4 Isotype Control S228P/R409K

Sign In for Pricing
View Details
Liraglutide 50mg
A16115-50 50 mg

Liraglutide 50mg

Sign In for Pricing
View Details
Mouse Rabac1 (NM_010261) AAV Particle
MR201709A1V 250 µL

Mouse Rabac1 (NM_010261) AAV Particle

Sign In for Pricing
View Details