Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 5/KLK5 (C-6His)

Source: Human Cells. MW :30.65kD. Recombinant Human Kallikrein 5 is produced by our Mammalian expression system and the target gene encoding Val23-Ser293 is expressed with a 6His tag at the C-terminus. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen Kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.

Product Specifications

Gene Name

KLK5

Gene ID

25818

UniProt

Q9Y337

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-APOA4 Monoclonal Antibody-Biotin
MF-0066891-01 25 µg

Anti-APOA4 Monoclonal Antibody-Biotin

Ask
View Details
Anti-APOA4 Monoclonal Antibody-Biotin
MF-0066891-02 50 µg

Anti-APOA4 Monoclonal Antibody-Biotin

Ask
View Details
Anti-APOA4 Monoclonal Antibody-Biotin
MF-0066891-03 100 µg

Anti-APOA4 Monoclonal Antibody-Biotin

Ask
View Details
Mouse monoclonal DPPA2 Antibody (OTI1G10)
NBP2-45680 0.1 mL

Mouse monoclonal DPPA2 Antibody (OTI1G10)

Ask
View Details
ZNF192 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51338151 3x 1.0 µg DNA

ZNF192 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Phospho-IKB alpha (Tyr42) Polyclonal Antibody, Biotin Conjugated
bs-5514R-Biotin 100 µL

Phospho-IKB alpha (Tyr42) Polyclonal Antibody, Biotin Conjugated

Ask
View Details