Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD83/HB15 (C-6His)

Source: Human Cells. MW :15.1kD. Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a 6His tag at the C-terminus. CD83 antigen is a single-pass type I membrane protein which contains one Ig-like V-type (immunoglobulin-like) domain. CD83 is expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells. It contains one Ig-like V-type (immunoglobulin-like) domain. , the soluble CD83 has the opposite effect and has an immune inhibitory capacity. Due to its immune inhibitory function, CD83 may play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Product Specifications

Gene Name

CD83

Gene ID

9308

UniProt

Q01151

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66d/CEACAM3 Protein (C-His, Human)
P502203 100 µg

CD66d/CEACAM3 Protein (C-His, Human)

Sign In for Pricing
View Details
TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)
MBS6442042-01 0.1 mL

TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)

Sign In for Pricing
View Details
TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)
MBS6442042-02 5x 0.1 mL

TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)

Sign In for Pricing
View Details
RelB Polyclonal Antibody, PerCP Conjugated
bs-3562R-PerCP 100 µL

RelB Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
MMP26 Rabbit Monoclonal Antibody
E56G4709 100 µL

MMP26 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
266-6 Cell Line
RWT-944 1x 10^6

266-6 Cell Line

Sign In for Pricing
View Details