Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD83/HB15 (C-6His)

Source: Human Cells. MW :15.1kD. Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a 6His tag at the C-terminus. CD83 antigen is a single-pass type I membrane protein which contains one Ig-like V-type (immunoglobulin-like) domain. CD83 is expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells. It contains one Ig-like V-type (immunoglobulin-like) domain. , the soluble CD83 has the opposite effect and has an immune inhibitory capacity. Due to its immune inhibitory function, CD83 may play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Product Specifications

Gene Name

CD83

Gene ID

9308

UniProt

Q01151

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal HERC2 Antibody [Alexa Fluor 405]
NBP2-98017AF405 0.1 mL

Rabbit Polyclonal HERC2 Antibody [Alexa Fluor 405]

Ask
View Details
Phosphatidylinositol 3-Kinase regulatory subunit α (PIK3R1) Human ELISA Kit
F8337 96 Tests

Phosphatidylinositol 3-Kinase regulatory subunit α (PIK3R1) Human ELISA Kit

Ask
View Details
Recombinant Human HAUS3 Protein
E30P6866 20 µg

Recombinant Human HAUS3 Protein

Ask
View Details
SYVN1 Antibody
A62424-100UL 100 µL

SYVN1 Antibody

Ask
View Details
VSV G tag Rabbit Monoclonal Antibody
E49B0053 100 µL

VSV G tag Rabbit Monoclonal Antibody

Ask
View Details