Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD83/HB15 (C-6His)

Source: Human Cells. MW :15.1kD. Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a 6His tag at the C-terminus. CD83 antigen is a single-pass type I membrane protein which contains one Ig-like V-type (immunoglobulin-like) domain. CD83 is expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells. It contains one Ig-like V-type (immunoglobulin-like) domain. , the soluble CD83 has the opposite effect and has an immune inhibitory capacity. Due to its immune inhibitory function, CD83 may play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Product Specifications

Gene Name

CD83

Gene ID

9308

UniProt

Q01151

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pallidin (BLOC1S6) Human qPCR Template Standard (NM_012388)
HK205668 1 Kit

Pallidin (BLOC1S6) Human qPCR Template Standard (NM_012388)

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (rAKT1/2491), 0.2mg/mL
BNUB3786-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (rAKT1/2491), 0.2mg/mL

Sign In for Pricing
View Details
NR1D2 Rabbit Polyclonal Antibody (AP)
orb958377 100 µL

NR1D2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Mouse LGALS9 Protein
orb80389-01 2 µg

Mouse LGALS9 Protein

Sign In for Pricing
View Details
Mouse LGALS9 Protein
orb80389-02 10 µg

Mouse LGALS9 Protein

Sign In for Pricing
View Details
Mouse LGALS9 Protein
orb80389-03 1 mg

Mouse LGALS9 Protein

Sign In for Pricing
View Details