Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD83/HB15 (C-6His)

Source: Human Cells. MW :15.1kD. Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a 6His tag at the C-terminus. CD83 antigen is a single-pass type I membrane protein which contains one Ig-like V-type (immunoglobulin-like) domain. CD83 is expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells. It contains one Ig-like V-type (immunoglobulin-like) domain. , the soluble CD83 has the opposite effect and has an immune inhibitory capacity. Due to its immune inhibitory function, CD83 may play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Product Specifications

Gene Name

CD83

Gene ID

9308

UniProt

Q01151

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TDP1 (Tyrosyl-DNA Phosphodiesterase 1, Tyr-DNA Phosphodiesterase 1) (MaxLight 650)
134315-ML650 100 µL

TDP1 (Tyrosyl-DNA Phosphodiesterase 1, Tyr-DNA Phosphodiesterase 1) (MaxLight 650)

Ask
View Details
Hsa-miR-107 inhibitor
HY-RI00057-01 5 nmol

Hsa-miR-107 inhibitor

Ask
View Details
Hsa-miR-107 inhibitor
HY-RI00057-02 20 nmol

Hsa-miR-107 inhibitor

Ask
View Details
FKBP14 (FK506-binding Protein 14, 22kD FKBP, EDSKMH, FKBP22, IPBP12) discontinued
210857-01 50 µL

FKBP14 (FK506-binding Protein 14, 22kD FKBP, EDSKMH, FKBP22, IPBP12) discontinued

Ask
View Details
FKBP14 (FK506-binding Protein 14, 22kD FKBP, EDSKMH, FKBP22, IPBP12) discontinued
210857-02 100 µL

FKBP14 (FK506-binding Protein 14, 22kD FKBP, EDSKMH, FKBP22, IPBP12) discontinued

Ask
View Details
FKBP14 (FK506-binding Protein 14, 22kD FKBP, EDSKMH, FKBP22, IPBP12) discontinued
210857-03 200 µL

FKBP14 (FK506-binding Protein 14, 22kD FKBP, EDSKMH, FKBP22, IPBP12) discontinued

Ask
View Details