Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin D/CTSD (C-6His)

Source: Human Cells. MW :43.8kD. Recombinant Human Cathepsin D is produced by our Mammalian expression system and the target gene encoding Leu21-Leu412 is expressed with a 6His tag at the C-terminus. The protein acid protease active in intracellular protein breakdown and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. It is specificity similar to, but narrower than, that of pepsin A and it does not cleave the 4-Gln-|-His-5 bond in B chain of insulin. It consists of a light chain and a heavy chain and expressed in the aorta extrcellular space. The Val-58 allele is significantly overrepresented in demented patients (11.8%) compared with non-demented controls (4.9%) . Carriers of the Val-58 allele have a 3.1-fold increased risk for developing AD than non-carriers.It belongs to the peptidase A1 family

Product Specifications

Gene Name

CTSD

Gene ID

1509

UniProt

P07339

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal IQCF1 Antibody
NBP1-60087 100 µL

Rabbit Polyclonal IQCF1 Antibody

Ask
View Details
Lentiviral human AKR1C1 shRNA (UAS) - Lentiviral human AKR1C1 shRNA (UAS) (25)
GTR15329072 1 Vial

Lentiviral human AKR1C1 shRNA (UAS) - Lentiviral human AKR1C1 shRNA (UAS) (25)

Ask
View Details