Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin B/CTSB (C-6His)

Source: Human Cells. MW :36.9kD. Recombinant Human Cathepsin B is produced by our Mammalian expression system and the target gene encoding Arg18-Ile339 is expressed with a 6His tag at the C-terminus. Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene. Cystatin-B / CSTB is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. Cystatin-B / CSTB is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. Cystatin-B / CSTB is also thought to play a role in protecting against the proteases leaking from lysosomes

Product Specifications

Gene Name

CTSB

Gene ID

1508

UniProt

P07858

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 17000pmol/min/ug

Amino Acids

RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMGYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LSS (NM_001001438) Human Tagged ORF Clone Lentiviral Particle
RC214463L4V 200 µL

LSS (NM_001001438) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)
MBS2018413-01 0.01 mg

Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)

Ask
View Details
Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)
MBS2018413-02 0.05 mg

Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)

Ask
View Details
Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)
MBS2018413-03 0.1 mg

Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)

Ask
View Details
Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)
MBS2018413-04 0.2 mg

Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)

Ask
View Details
Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)
MBS2018413-05 0.5 mg

Recombinant Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1)

Ask
View Details