Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin B/CTSB (C-6His)

Source: Human Cells. MW :36.9kD. Recombinant Human Cathepsin B is produced by our Mammalian expression system and the target gene encoding Arg18-Ile339 is expressed with a 6His tag at the C-terminus. Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene. Cystatin-B / CSTB is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. Cystatin-B / CSTB is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. Cystatin-B / CSTB is also thought to play a role in protecting against the proteases leaking from lysosomes

Product Specifications

Gene Name

CTSB

Gene ID

1508

UniProt

P07858

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 17000pmol/min/ug

Amino Acids

RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMGYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Selection and Upkeep of Intraepithelial T-Cells Protein 6 (SKINT6) ELISA Kit
abx546022 96 Tests

Mouse Selection and Upkeep of Intraepithelial T-Cells Protein 6 (SKINT6) ELISA Kit

Ask
View Details
RNF19B (NM_001127361) Human Tagged Lenti ORF Clone
RC225991L3 10 µg

RNF19B (NM_001127361) Human Tagged Lenti ORF Clone

Ask
View Details
Cell Division Cycle 45 Rabbit Monoclonal Antibody [KD Validation]
E51K2954 40 µL

Cell Division Cycle 45 Rabbit Monoclonal Antibody [KD Validation]

Ask
View Details
APC anti-human CD56 (NCAM) Recombinant
GT16801 100 Tests

APC anti-human CD56 (NCAM) Recombinant

Ask
View Details
GSK-J4 5mg
A12732-5 5 mg

GSK-J4 5mg

Ask
View Details
Disintegrin and metalloProteinase domain-containing Protein 9 (ADAM9)
313560-01 50 µL

Disintegrin and metalloProteinase domain-containing Protein 9 (ADAM9)

Ask
View Details