Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin D/CSTD/CST5 (C-6His)

Source: Human Cells. MW :14.9kD. Recombinant Human Cystatin D is produced by our Mammalian expression system and the target gene encoding Gly21-Val142 is expressed with a 6His tag at the C-terminus. Cystatin-D is a protein that in humans is encoded by the CST5 gene. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity.

Product Specifications

Gene Name

CST5

Gene ID

1473

UniProt

P28325

Components

Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKVVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Inhibin beta C Antibody
E38PA7333 100 µL

Inhibin beta C Antibody

Ask
View Details
Sodium Salicylate 500mg
A16716-500 500 mg

Sodium Salicylate 500mg

Ask
View Details
TSPAN8 Rabbit pAb
A13267-01 20 µL

TSPAN8 Rabbit pAb

Ask
View Details
TSPAN8 Rabbit pAb
A13267-02 100 μL

TSPAN8 Rabbit pAb

Ask
View Details
TSPAN8 Rabbit pAb
A13267-03 500 μL

TSPAN8 Rabbit pAb

Ask
View Details
TSPAN8 Rabbit pAb
A13267-04 1000 μL

TSPAN8 Rabbit pAb

Ask
View Details