Recombinant Human Cystatin D/CSTD/CST5 (C-6His)
Source: Human Cells. MW :14.9kD. Recombinant Human Cystatin D is produced by our Mammalian expression system and the target gene encoding Gly21-Val142 is expressed with a 6His tag at the C-terminus. Cystatin-D is a protein that in humans is encoded by the CST5 gene. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity.
Product Specifications
Gene Name
CST5
Gene ID
1473
UniProt
P28325
Components
Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKVVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items