Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitronectin/VTN (C-6His)

Source: Human Cells. MW :53.35kD. Recombinant Human Vitronectin is produced by our Mammalian expression system and the target gene encoding Asp20-Leu478 is expressed with a 6His tag at the C-terminus. Human Vitronectin/VTN is a cell adhesion and spreading factor. It can be found in the blood and the extracellular matrix (ECM) . Vitronectin interacts with glycosaminoglycans and proteoglycans. The multimeric Vitronectin can efficiently bind to and incorporate into the ECM; Vitronectin can support cell adhesion through binding to various integrins and other proteoglycans. Vitronectin can be recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecular. It can as a inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway. Vitronectin contains an endogenous cleavage site, plus cleavage sites for elastase, thrombin, and plasmin.

Product Specifications

Gene Name

VTN

Gene ID

7448

UniProt

P04004

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHLVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human CD3 (Otelixizumab Biosimilar)
BIO0708SM-1mg 1 mg

Anti-human CD3 (Otelixizumab Biosimilar)

Sign In for Pricing
View Details
AACT Recombinant Rabbit mAb, FITC conjugated
orb3001044 100 µL

AACT Recombinant Rabbit mAb, FITC conjugated

Sign In for Pricing
View Details
Fractalkine (Human) BioAssayTM ELISA Kit
472158 96 Tests

Fractalkine (Human) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Phospho-Tuberin (Ser939) Rabbit mAb
C06164-01 20 µL

Phospho-Tuberin (Ser939) Rabbit mAb

Sign In for Pricing
View Details
Phospho-Tuberin (Ser939) Rabbit mAb
C06164-02 100 µL

Phospho-Tuberin (Ser939) Rabbit mAb

Sign In for Pricing
View Details
Phospho-Tuberin (Ser939) Rabbit mAb
C06164-03 2x 100 μL

Phospho-Tuberin (Ser939) Rabbit mAb

Sign In for Pricing
View Details