Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urokinase-Type Plasminogen Activator/uPA/PLAU (C-6His)

Source: Human Cells. MW :47.41kD. Recombinant Human Urokinase is produced by our Mammalian expression system and the target gene encoding Ser21-Leu431 is expressed with a 6His tag at the C-terminus. Recombinant Human Urokinase-Type Plasminogen Activator is a serine protease, which specifically cleaves the zymogen plasminogen to form the active enzyme plasmin. Urokinase-Type Plasminogen Activator is a potent marker of invasion and metastasis in many human cancers associated with breast, colon, stomach, bladder, brain, ovary and endometrium. Human Urokinase-Type Plasminogen Activator is initially synthesized as 431 amino acid precursor with a N-terminal signal peptide residues. The single chain molecule is processed into a disulfide-linked two-chain molecule. There exists two forms A chain, the long A chain contains an EGF-like domain that is responsible for binding of the uPA receptor. The B chain corresponds to the catalytic domain.

Product Specifications

Gene Name

PLAU

Gene ID

5328

UniProt

P00749

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 2mM CaCl, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLALVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Twinfilin 2 Antibody / TWF2 / PTK9L
F54606-0.08ML 0.08 mL

Twinfilin 2 Antibody / TWF2 / PTK9L

Ask
View Details
Rabbit Monoclonal PRDM4 Antibody (RAB-C367) [mFluor Violet 450 SE]
NBP3-20139MFV450 0.1 mL

Rabbit Monoclonal PRDM4 Antibody (RAB-C367) [mFluor Violet 450 SE]

Ask
View Details
PKHD1 (Polycystic Kidney and Hepatic Disease 1, ARPKD, DKFZp686C01112, Fibrocystin, FCYT, FLJ46150, Polyductin, Tigmin, TIGM1)
P4210-70C 100 µL

PKHD1 (Polycystic Kidney and Hepatic Disease 1, ARPKD, DKFZp686C01112, Fibrocystin, FCYT, FLJ46150, Polyductin, Tigmin, TIGM1)

Ask
View Details
Human Monoclonal FOLR1 Antibody (Dompe patent anti-FOLR1) [Janelia Fluor 635]
NBP3-28044JF635 0.1 mL

Human Monoclonal FOLR1 Antibody (Dompe patent anti-FOLR1) [Janelia Fluor 635]

Ask
View Details
Melanoma Associated Antigen Antibody / MAA
V8899-100UG 100 µg

Melanoma Associated Antigen Antibody / MAA

Ask
View Details
Vmn1r228 (NM_134192) Mouse Tagged ORF Clone
MG225053 10 µg

Vmn1r228 (NM_134192) Mouse Tagged ORF Clone

Ask
View Details