Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urokinase-Type Plasminogen Activator/uPA/PLAU (C-6His)

Source: Human Cells. MW :47.41kD. Recombinant Human Urokinase is produced by our Mammalian expression system and the target gene encoding Ser21-Leu431 is expressed with a 6His tag at the C-terminus. Recombinant Human Urokinase-Type Plasminogen Activator is a serine protease, which specifically cleaves the zymogen plasminogen to form the active enzyme plasmin. Urokinase-Type Plasminogen Activator is a potent marker of invasion and metastasis in many human cancers associated with breast, colon, stomach, bladder, brain, ovary and endometrium. Human Urokinase-Type Plasminogen Activator is initially synthesized as 431 amino acid precursor with a N-terminal signal peptide residues. The single chain molecule is processed into a disulfide-linked two-chain molecule. There exists two forms A chain, the long A chain contains an EGF-like domain that is responsible for binding of the uPA receptor. The B chain corresponds to the catalytic domain.

Product Specifications

Gene Name

PLAU

Gene ID

5328

UniProt

P00749

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 2mM CaCl, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLALVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CSF3R, ID (CSF3R, GCSFR, Granulocyte colony-stimulating factor receptor, CD114) (FITC) discontinued
034274-FITC 200 µL

CSF3R, ID (CSF3R, GCSFR, Granulocyte colony-stimulating factor receptor, CD114) (FITC) discontinued

Ask
View Details
PI 3 Kinase p85 beta
526930-01 100 µL

PI 3 Kinase p85 beta

Ask
View Details
PI 3 Kinase p85 beta
526930-02 200 µL

PI 3 Kinase p85 beta

Ask
View Details
Lentiviral mouse Kdm4b shRNA (UAS) - Lentiviral mouse Kdm4b shRNA (UAS, RFP) (100)
GTR15146616 1 Vial

Lentiviral mouse Kdm4b shRNA (UAS) - Lentiviral mouse Kdm4b shRNA (UAS, RFP) (100)

Ask
View Details
Adenosine Monophosphate Assay Kit
MBS169613-01 100 Assays

Adenosine Monophosphate Assay Kit

Ask
View Details
Adenosine Monophosphate Assay Kit
MBS169613-02 5x 100 Assays

Adenosine Monophosphate Assay Kit

Ask
View Details