Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TWSG1/TSG (C-6His)

Source: Human Cells. MW :23.18kD. Recombinant Human TWSG1 is produced by our Mammalian expression system and the target gene encoding Cys26-Phe223 is expressed with a 6His tag at the C-terminus. Twisted Gastrulation Protein Homolog 1 (TWSG1) is a 22 kDa secreted protein that belongs to the twisted gastrulation protein family. Human TWSG1 is synthesized as a 223 aa precursor that contains a 25 aa signal peptide and a 198 aa mature chain. TWSG1 may be involved in dorsoventral axis formation. TWSG1 seems to antagonize BMP signaling by forming ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors.TWSG1 can inhibit BMP activity by binding directly to BMP proteins, and can act the anti-BMP function, partly mediated by cleavage and degradation of CHRD, which releases BMPs from ternary complexes. TWSG1 may be an important modulator of BMP-regulated cartilage development, chondrocyte differentiation and thymocyte development.

Product Specifications

Gene Name

TWSG1

Gene ID

57045

UniProt

Q9GZX9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMFVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Ethylpyridine-2-carboxylic Acid
TRC-E925505-500MG 500 mg

5-Ethylpyridine-2-carboxylic Acid

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF405S conjugate, 0.1mg/mL
BNC042329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin (MYL4) Mouse Monoclonal Antibody [Clone ID: OTI3H6]
CF807580 100 µg

Myosin (MYL4) Mouse Monoclonal Antibody [Clone ID: OTI3H6]

Sign In for Pricing
View Details
Phenthoate (>90%)
TRC-P318825-1G 1 g

Phenthoate (>90%)

Sign In for Pricing
View Details
7-Chloro-4-nitroquinoline
TRC-C374830-5MG 5 mg

7-Chloro-4-nitroquinoline

Sign In for Pricing
View Details
OR8K3 (C-term) Rabbit Polyclonal Antibody
AP53110PU-N 400 µL

OR8K3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details