Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TWSG1/TSG (C-6His)

Source: Human Cells. MW :23.18kD. Recombinant Human TWSG1 is produced by our Mammalian expression system and the target gene encoding Cys26-Phe223 is expressed with a 6His tag at the C-terminus. Twisted Gastrulation Protein Homolog 1 (TWSG1) is a 22 kDa secreted protein that belongs to the twisted gastrulation protein family. Human TWSG1 is synthesized as a 223 aa precursor that contains a 25 aa signal peptide and a 198 aa mature chain. TWSG1 may be involved in dorsoventral axis formation. TWSG1 seems to antagonize BMP signaling by forming ternary complexes with CHRD and BMPs, thereby preventing BMPs from binding to their receptors.TWSG1 can inhibit BMP activity by binding directly to BMP proteins, and can act the anti-BMP function, partly mediated by cleavage and degradation of CHRD, which releases BMPs from ternary complexes. TWSG1 may be an important modulator of BMP-regulated cartilage development, chondrocyte differentiation and thymocyte development.

Product Specifications

Gene Name

TWSG1

Gene ID

57045

UniProt

Q9GZX9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMFVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Pancreatic Cancer Cells [PANC10.05]
AFG-ELL-0293 > 1x 10^6 Cells / Vial

Human Pancreatic Cancer Cells [PANC10.05]

Ask
View Details
CC106, ID (CCDC106, Coiled-coil domain-containing protein 106) (MaxLight 490) discontinued
033261-ML490 100 µL

CC106, ID (CCDC106, Coiled-coil domain-containing protein 106) (MaxLight 490) discontinued

Ask
View Details
MAX (Phospho-Ser2) Antibody
MBS9502864-01 0.05 mL

MAX (Phospho-Ser2) Antibody

Ask
View Details
MAX (Phospho-Ser2) Antibody
MBS9502864-02 0.1 mL

MAX (Phospho-Ser2) Antibody

Ask
View Details
MAX (Phospho-Ser2) Antibody
MBS9502864-03 5x 0.1 mL

MAX (Phospho-Ser2) Antibody

Ask
View Details
Rabbit Bromodeoxyuridine (BrdU) ELISA Kit
EIA05391Rb 1 Kit

Rabbit Bromodeoxyuridine (BrdU) ELISA Kit

Ask
View Details