Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue Factor Pathway Inhibitor 2/TFPI-2/PP5/REF-1 (C-6His)

Source: Human Cells. MW :22.88kD. Recombinant Human Tissue Factor Pathway Inhibitor 2 is produced by our Mammalian expression system and the target gene encoding Asp23-Lys213 is expressed with a 6His tag at the C-terminus. Human Tissue Factor Pathway Inhibitor 2 (TFPI2) has a N-terminal acidic region, three Kunita domains separated with by two linker regions, and a C-terminal basic region. TFPI2 has the function of regulating plasmin-mediated matrix remodeling, inhibits trypsin, plasmin, factor Vlla/tissue factor and weakly factor Xa.. TFPI2 has no effect on thrombin. TFPI2 may contribute to tumor progression in many cancers; in these cancers, the expression of TFPI2 can be down-regulated.

Product Specifications

Gene Name

TFPI2

Gene ID

7980

UniProt

P48307

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rg9mtd2 Adenovirus (Mouse)
38890054 1.0 mL

Rg9mtd2 Adenovirus (Mouse)

Sign In for Pricing
View Details
ZNF528 antibody - middle region (ARP36066_P050)
ARP36066_P050 100 µL

ZNF528 antibody - middle region (ARP36066_P050)

Sign In for Pricing
View Details
Orn8, Urotensin II, human
5-01657 4x 1 mg

Orn8, Urotensin II, human

Sign In for Pricing
View Details
IL-4 Protein, Rat, Recombinant
TMPX-00002-01 100 µg

IL-4 Protein, Rat, Recombinant

Sign In for Pricing
View Details
IL-4 Protein, Rat, Recombinant
TMPX-00002-02 5 µg

IL-4 Protein, Rat, Recombinant

Sign In for Pricing
View Details
IL-4 Protein, Rat, Recombinant
TMPX-00002-03 500 µg

IL-4 Protein, Rat, Recombinant

Sign In for Pricing
View Details