Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLAM Family Member 6/SLAMF6/CD352/NTB-A (C-6His)

Source: Human Cells. MW :23.98kD. Recombinant Human SLAMF6 is produced by our Mammalian expression system and the target gene encoding Leu28-Lys225 is expressed with a 6His tag at the C-terminus. SLAM Family Member 6 (SLAMF6) is a 60 kD single-pass type I membrane protein that belongs to the SLAM subgroup of the CD2 family. Human SLAMF6/ NTB-A contains a 205 amino acid extracellular domain (ECD) with one Ig-like V-set and one Ig-like C2-set domain, a 21 amino acid transmembrane segment and an 84 amino acid cytoplasmic domain, with two immunoreceptor tyrosine-based switch motifs. SLAMF6 is a homodimer. SLAMF6 can interact with PTN6 and, upon phosphorylation, with PTN11 and SH2D1A/SAP. Phosphorylation-dependent NTB-A association with SAP is required for full production of IFN- gamma by NK cells and independent of EAT-2 binding. It Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. On B cells, NTB-A modulates immunoglobulin class switching and the balance between tolerance and autoimmunity.

Product Specifications

Gene Name

SLAMF6

Gene ID

114836

UniProt

Q96DU3

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GM-CSFR alpha Antibody (31916) [PE/Cy7]
FAB706PECY7 0.5 mL

Mouse Monoclonal GM-CSFR alpha Antibody (31916) [PE/Cy7]

Sign In for Pricing
View Details
Prg3 sgRNA CRISPR Lentivector set (Rat)
K6041601 3x 1.0 µg

Prg3 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal DDIT4 Antibody (PS00-10)
NBP3-32259 100 µL

Rabbit Monoclonal DDIT4 Antibody (PS00-10)

Sign In for Pricing
View Details
Lentiviral mouse Gsto2 shRNA (UAS) - Lentiviral mouseGsto2 shRNA (UAS, GFP) (25)
GTR15294179 1 Vial

Lentiviral mouse Gsto2 shRNA (UAS) - Lentiviral mouseGsto2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Rtn4rl1 shRNA (UAS) - Lentiviral mouse Rtn4rl1 shRNA (UAS, iRFP) (100)
GTR15277983 1 Vial

Lentiviral mouse Rtn4rl1 shRNA (UAS) - Lentiviral mouse Rtn4rl1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TMEM24 Blocking Peptide
33R-8462 100 ug

TMEM24 Blocking Peptide

Sign In for Pricing
View Details