Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLAM Family Member 6/SLAMF6/CD352/NTB-A (C-6His)

Source: Human Cells. MW :23.98kD. Recombinant Human SLAMF6 is produced by our Mammalian expression system and the target gene encoding Leu28-Lys225 is expressed with a 6His tag at the C-terminus. SLAM Family Member 6 (SLAMF6) is a 60 kD single-pass type I membrane protein that belongs to the SLAM subgroup of the CD2 family. Human SLAMF6/ NTB-A contains a 205 amino acid extracellular domain (ECD) with one Ig-like V-set and one Ig-like C2-set domain, a 21 amino acid transmembrane segment and an 84 amino acid cytoplasmic domain, with two immunoreceptor tyrosine-based switch motifs. SLAMF6 is a homodimer. SLAMF6 can interact with PTN6 and, upon phosphorylation, with PTN11 and SH2D1A/SAP. Phosphorylation-dependent NTB-A association with SAP is required for full production of IFN- gamma by NK cells and independent of EAT-2 binding. It Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. On B cells, NTB-A modulates immunoglobulin class switching and the balance between tolerance and autoimmunity.

Product Specifications

Gene Name

SLAMF6

Gene ID

114836

UniProt

Q96DU3

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-Uba2-3xFLAG-CopGFP-Puro Plasmid
PVT75976 2 µg

PLV3-CMV-Uba2-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Poliovirus 3 Antibody (45 D5) [Janelia Fluor 646]
NBP1-05102JF646 0.1 mL

Mouse Monoclonal Poliovirus 3 Antibody (45 D5) [Janelia Fluor 646]

Sign In for Pricing
View Details
Cathepsin D Human Protein
PR27139-10 10 µg

Cathepsin D Human Protein

Sign In for Pricing
View Details
MAP Kinase Kinase 5 (Ser149) (Dual Specificity Mitogen-activated Protein Kinase Kinase 5, MAP2K5, MAPKK 5, MAPKK5, MKK5, PRKMK5, HsT17454, MAPK/ERK Kinase 5, MEK 5, MEK5) (MaxLight 490) discontinued
M2363-19M-ML490 100 µL

MAP Kinase Kinase 5 (Ser149) (Dual Specificity Mitogen-activated Protein Kinase Kinase 5, MAP2K5, MAPKK 5, MAPKK5, MKK5, PRKMK5, HsT17454, MAPK/ERK Kinase 5, MEK 5, MEK5) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ICP Multi Elem (3) Std As Mn Pb 100 ppm in 5% HNO3 - 100ML
MSICP001 100 mL

ICP Multi Elem (3) Std As Mn Pb 100 ppm in 5% HNO3 - 100ML

Sign In for Pricing
View Details
Human PDGF-BB (Platelet Derived Growth Factor-BB) CLIA Kit
MBS2533230-01 96 Tests

Human PDGF-BB (Platelet Derived Growth Factor-BB) CLIA Kit

Sign In for Pricing
View Details