Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biglycan/BGN (C-6His)

Source: Human Cells. MW :40.47kD. Recombinant Human Biglycan is produced by our Mammalian expression system and the target gene encoding Glu20-Lys368 is expressed with a 6His tag at the C-terminus. Biglycan is a 200-350 kD proteoglycan consisting of a 45 kD core protein and two chrondroitin/dermatan sulfate glycosaminoglycan chains. Biglycan binds to TGF- beta. It also binds to collagen type I in low ionic strength (less than 3 mM phosphate) buffer. At higher ionic strengths, Biglycan does not bind to collagen type I. It enhances the inhibition effect of TGF- beta on osteoclast proliferation at a concentration of 4-20 mg/ml. It also prevents the attachment of CHO cells to fibronectin, with a 50% inhibition at 17-21 mg/ml.

Product Specifications

Gene Name

BGN

Gene ID

633

UniProt

P21810

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RG9MTD1 Peptide - middle region (AAP40877)
AAP40877-100UG 100 µg

RG9MTD1 Peptide - middle region (AAP40877)

Sign In for Pricing
View Details
NT5C1A Antibody
orb521298-01 50 μL

NT5C1A Antibody

Sign In for Pricing
View Details
NT5C1A Antibody
orb521298-02 100 µL

NT5C1A Antibody

Sign In for Pricing
View Details
ATL3 Antibody (Center) Blocking Peptide
MBS9225338-01 0.5 mg

ATL3 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
ATL3 Antibody (Center) Blocking Peptide
MBS9225338-02 5x 0.5 mg

ATL3 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Mouse Monoclonal CLEC9a Antibody (14N8D7) [DyLight 650]
NBP2-27087C 0.1 mL

Mouse Monoclonal CLEC9a Antibody (14N8D7) [DyLight 650]

Sign In for Pricing
View Details