Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biglycan/BGN (C-6His)

Source: Human Cells. MW :40.47kD. Recombinant Human Biglycan is produced by our Mammalian expression system and the target gene encoding Glu20-Lys368 is expressed with a 6His tag at the C-terminus. Biglycan is a 200-350 kD proteoglycan consisting of a 45 kD core protein and two chrondroitin/dermatan sulfate glycosaminoglycan chains. Biglycan binds to TGF- beta. It also binds to collagen type I in low ionic strength (less than 3 mM phosphate) buffer. At higher ionic strengths, Biglycan does not bind to collagen type I. It enhances the inhibition effect of TGF- beta on osteoclast proliferation at a concentration of 4-20 mg/ml. It also prevents the attachment of CHO cells to fibronectin, with a 50% inhibition at 17-21 mg/ml.

Product Specifications

Gene Name

BGN

Gene ID

633

UniProt

P21810

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD3 CRISPRa sgRNA lentivector (set of three targets)(Human)
43523121 3x 1.0µg DNA

SETD3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Fam73a ORF Vector (Mouse) (pORF)
20103015 1.0 µg DNA

Fam73a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
TRV-0034692-01 20 µL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
TRV-0034692-02 100 µL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
TRV-0034692-03 200 µL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
TRV-0034692-04 1 mL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details