Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 (C-6His)

Source: Human Cells. MW :31.56kD. Recombinant Human Tryptase epsilon is produced by our Mammalian expression system and the target gene encoding Ala33-Ser317 is expressed with a 6His tag at the C-terminus. Brain-Specific Serine Protease 4 (BSSP-4) is a serine protease that preferentially cleaves the synthetic substrate H-D-Leu-Thr-Arg-pNA compared to tosyl-Gly-Pro-Arg-pNA. BSSP-4 is expressed abundantly in the epithelial cells of the airways, including trachea, esophagus and fetal lung, but scarce in adult lung and expressed at low levels in placenta, pancreas, prostate and thyroid gland. BSSP-4 belongs to the peptidase S1 family and related to trypsin, referentially hydrolyzing substrates after arginine and lysine residues. However, BSSP-4 is less susceptible to inhibition by common trypsin inhibitors such as aprotinin, a1-antitrypsin and secretory leukocyte protease inhibitor. BSSP-4 efficiently converts pro-urokinase- type plasminogen activator to its mature, active form.

Product Specifications

Gene Name

PRSS22

Gene ID

64063

UniProt

Q9GZN4

Components

Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, 10% Glycerol, pH 4.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Phospho-c-Jun (Thr91) Polyclonal Antibody, PE-Cy5 Conjugated
bs-5458R-PE-Cy5 100 µL

Phospho-c-Jun (Thr91) Polyclonal Antibody, PE-Cy5 Conjugated

Ask
View Details
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA338248 100 µL

Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody

Ask
View Details
Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued
281517-01 25 g

Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued

Ask
View Details
Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued
281517-02 50 g

Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued

Ask
View Details
Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued
281517-03 100 g

Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued

Ask
View Details
Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued
281517-04 250 g

Lithium Tri-tert-butoxyaluminum Hydride (ca. 30% in Tetrahydrofuran, ca. 1.0mol/L) discontinued

Ask
View Details