Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tryptase epsilon/Brain-Specific Serine Protease 4/BSSP-4 (C-6His)

Source: Human Cells. MW :31.56kD. Recombinant Human Tryptase epsilon is produced by our Mammalian expression system and the target gene encoding Ala33-Ser317 is expressed with a 6His tag at the C-terminus. Brain-Specific Serine Protease 4 (BSSP-4) is a serine protease that preferentially cleaves the synthetic substrate H-D-Leu-Thr-Arg-pNA compared to tosyl-Gly-Pro-Arg-pNA. BSSP-4 is expressed abundantly in the epithelial cells of the airways, including trachea, esophagus and fetal lung, but scarce in adult lung and expressed at low levels in placenta, pancreas, prostate and thyroid gland. BSSP-4 belongs to the peptidase S1 family and related to trypsin, referentially hydrolyzing substrates after arginine and lysine residues. However, BSSP-4 is less susceptible to inhibition by common trypsin inhibitors such as aprotinin, a1-antitrypsin and secretory leukocyte protease inhibitor. BSSP-4 efficiently converts pro-urokinase- type plasminogen activator to its mature, active form.

Product Specifications

Gene Name

PRSS22

Gene ID

64063

UniProt

Q9GZN4

Components

Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, 10% Glycerol, pH 4.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf72 (NM_018325) Human Tagged Lenti ORF Clone
RC209700L1 10 µg

C9orf72 (NM_018325) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FCER1A Antibody, Biotin conjugated
A21741-50UG 50 µg

FCER1A Antibody, Biotin conjugated

Sign In for Pricing
View Details
Osbp (NM_001033174) Mouse Recombinant Protein
TP515637 20 µg

Osbp (NM_001033174) Mouse Recombinant Protein

Sign In for Pricing
View Details
HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 490) discontinued
036791-ML490 100 µL

HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Taar7a Pre-designed siRNA Set B
SI114183B 1 Each

Mouse Taar7a Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit anti-RPS5 Antibody
MBS4511340-01 0.05 mL

Rabbit anti-RPS5 Antibody

Sign In for Pricing
View Details