Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urokinase Plasminogen Activator Surface Receptor/uPAR (C-6His)

Source: Human Cells. MW :32.6kD. Recombinant Human PLAUR is produced by our Mammalian expression system and the target gene encoding Leu23-Arg303 is expressed with a 6His tag at the C-terminus. The Urokinase Type Plasminogen Activator (uPA) receptor (uPAR) is a widely expressed receptor for urokinase plasminogen activator (uPA) and pro-uPA. uPAR / CD87 is a highly glycosylated, 55-60kDa integral membrane protein linked to the plasma membrane by a glycosylphosphatidylinositol (GPI) anchor. uPAR is expressed by T-cells, NK cells, monocytes, and neutrophils as well as non-hematopoietic cells that include vascular endothelial cells, fibroblasts, smooth muscle cells, keratinocytes, placental trophoblasts, hepatocytes, and a wide variety of tumor cells (including breast, colon, and prostate carcinoma, melanoma) . It plays a critical role in the regulation of cell-surface plasminogen activation in physiological and pathological conditions, and it is also involved in cellular adhesion, the transmission of extracellular signals across the plasma membrane and the subsequent regulation of gene expression. uPAR has been implicated in several biological processes including angiogenesis, monocyte migration, cancer metastasis, trophoblast implantation, and wound healing. Human uPAR is encoded as a 313 amino acid residue polypeptide, excluding a 22 residue signal peptide and shows 60-70% similarity with the murine uPAR amino acid sequence although binding of uPA to uPAR shows strong species specificity.

Product Specifications

Gene Name

PLAUR

Gene ID

5329

UniProt

Q03405

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UBE2L2 Adenovirus (Human)
48980051 1.0 mL

UBE2L2 Adenovirus (Human)

Ask
View Details
Gdf3 (NM_001109671) Rat Tagged ORF Clone Lentiviral Particle
RR208038L4V 200 µL

Gdf3 (NM_001109671) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
HKDC1 (Hexokinase Domain Containing 1, FLJ22761, FLJ37767, MGC125688)
247101 100 µg

HKDC1 (Hexokinase Domain Containing 1, FLJ22761, FLJ37767, MGC125688)

Ask
View Details
HFE (Hereditary Hemochromatosis Protein, HFE1, dJ221C16.10.1, HLAH, HLA-H, HH, MGC103790, MVCD7)
H2500-04 200 µL

HFE (Hereditary Hemochromatosis Protein, HFE1, dJ221C16.10.1, HLAH, HLA-H, HH, MGC103790, MVCD7)

Ask
View Details
BETVII Antibody (Biotin)
abx300406-01 20 µg

BETVII Antibody (Biotin)

Ask
View Details
BETVII Antibody (Biotin)
abx300406-02 50 µg

BETVII Antibody (Biotin)

Ask
View Details