Recombinant Human NCR3/NKp30/CD337 (C-6His)
Source: Human Cells. MW :12.84kD. Recombinant Human Natural Cytotoxicity Triggering Receptor 3 is produced by our Mammalian expression system and the target gene encoding Leu19-Thr138 is expressed with a 6His tag at the C-terminus. Natural Cytotoxicity Triggering Receptor 3 (NCR3) along with NKp44 and NKp46 constitute a group of receptors termed “Natural Cytotoxicity Receptorsâ€. They play a major role in triggering NK-mediated killing of most tumor cells lines. NKp30 is a type I transmembrane protein having a single extracellular V-like immunoglobulin domain. NKp30 is selectively expressed both in resting and activated human NK cells. In addition, NKp30 is also involved in NK-mediated induction of dendritic cell (DC) maturation. It has been demonstrated that NK cell activation signaling specifically induces lytic activity against several tumor cell types and synthesis of new NF-kB dependent proteins during the initiation of cytotoxicity.
Product Specifications
Gene Name
NCR3
Gene ID
259197
UniProt
O14931
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog