Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NCR3/NKp30/CD337 (C-6His)

Source: Human Cells. MW :12.84kD. Recombinant Human Natural Cytotoxicity Triggering Receptor 3 is produced by our Mammalian expression system and the target gene encoding Leu19-Thr138 is expressed with a 6His tag at the C-terminus. Natural Cytotoxicity Triggering Receptor 3 (NCR3) along with NKp44 and NKp46 constitute a group of receptors termed “Natural Cytotoxicity Receptors”. They play a major role in triggering NK-mediated killing of most tumor cells lines. NKp30 is a type I transmembrane protein having a single extracellular V-like immunoglobulin domain. NKp30 is selectively expressed both in resting and activated human NK cells. In addition, NKp30 is also involved in NK-mediated induction of dendritic cell (DC) maturation. It has been demonstrated that NK cell activation signaling specifically induces lytic activity against several tumor cell types and synthesis of new NF-kB dependent proteins during the initiation of cytotoxicity.

Product Specifications

Gene Name

NCR3

Gene ID

259197

UniProt

O14931

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Research Grade Sotatercept
MBS1580280-01 0.1 mg

Research Grade Sotatercept

Ask
View Details
Research Grade Sotatercept
MBS1580280-02 1 mg

Research Grade Sotatercept

Ask
View Details
Research Grade Sotatercept
MBS1580280-03 5x 1 mg

Research Grade Sotatercept

Ask
View Details
Recombinant ASFV K196R Protein, N-His
YVV11401 100 μg

Recombinant ASFV K196R Protein, N-His

Ask
View Details
Lentiviral human CACNA1E sgRNA gene knockout kit - Lentiviral human CACNA1E sgRNA gene knockout kit (plasmid)
GTR15361103 1 Vial

Lentiviral human CACNA1E sgRNA gene knockout kit - Lentiviral human CACNA1E sgRNA gene knockout kit (plasmid)

Ask
View Details
Mouse mmu-miR-6516-5p miRNA Antagomir
abx889091-01 10 nmol

Mouse mmu-miR-6516-5p miRNA Antagomir

Ask
View Details