Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix Metalloproteinase-3/MMP-3 (C-6His)

Source: Human Cells. MW :53.26kD. Recombinant Human Matrix Metalloproteinase-3 is produced by our Mammalian expression system and the target gene encoding Tyr18-Cys477 is expressed with a 6His tag at the C-terminus. MMP3 is a member of the matrix metalloproteinase (MMP) family whose members are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes including arthritis and metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling.[3] The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.

Product Specifications

Gene Name

MMP3

Gene ID

4314

UniProt

P08254

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNCVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Rae-1 Pan Specific Affinity Purified Polyclonal Ab
AF1136-SP 25 µg

Mouse Rae-1 Pan Specific Affinity Purified Polyclonal Ab

Ask
View Details
C030010C08Rik Mouse siRNA Oligo Duplex (Locus ID 77329)
SR400720 1 Kit

C030010C08Rik Mouse siRNA Oligo Duplex (Locus ID 77329)

Ask
View Details
Lentiviral mouse Tle6 shRNA (UAS) - Lentiviral mouse Tle6 shRNA (UAS) (25)
GTR15283769 1 Vial

Lentiviral mouse Tle6 shRNA (UAS) - Lentiviral mouse Tle6 shRNA (UAS) (25)

Ask
View Details
Mmu-miR-7011-3p antagomir
HY-RI03756A-01 5 nmol

Mmu-miR-7011-3p antagomir

Ask
View Details
Mmu-miR-7011-3p antagomir
HY-RI03756A-02 20 nmol

Mmu-miR-7011-3p antagomir

Ask
View Details
KIAA1522 Antibody
DF14276-01 100 µL

KIAA1522 Antibody

Ask
View Details