Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix Metalloproteinase-3/MMP-3 (C-6His)

Source: Human Cells. MW :53.26kD. Recombinant Human Matrix Metalloproteinase-3 is produced by our Mammalian expression system and the target gene encoding Tyr18-Cys477 is expressed with a 6His tag at the C-terminus. MMP3 is a member of the matrix metalloproteinase (MMP) family whose members are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes including arthritis and metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling.[3] The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.

Product Specifications

Gene Name

MMP3

Gene ID

4314

UniProt

P08254

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNCVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-ZNF598 Antibody, Affinity Purified
MBS3905253-01 0.01 mg

Rabbit anti-ZNF598 Antibody, Affinity Purified

Ask
View Details
Rabbit anti-ZNF598 Antibody, Affinity Purified
MBS3905253-02 0.1 mg

Rabbit anti-ZNF598 Antibody, Affinity Purified

Ask
View Details
Rabbit anti-ZNF598 Antibody, Affinity Purified
MBS3905253-03 5x 0.01 mg

Rabbit anti-ZNF598 Antibody, Affinity Purified

Ask
View Details
Rabbit anti-ZNF598 Antibody, Affinity Purified
MBS3905253-04 5x 0.1 mg

Rabbit anti-ZNF598 Antibody, Affinity Purified

Ask
View Details
Mouse Monoclonal ssDNA Antibody (TNT-3) [HRP]
NBP2-29849H 0.1 mL

Mouse Monoclonal ssDNA Antibody (TNT-3) [HRP]

Ask
View Details
GENLISA Human Proislet Amyloid Polypeptide (PROIAPP) ELISA
KBH15000 1x 96 Well

GENLISA Human Proislet Amyloid Polypeptide (PROIAPP) ELISA

Ask
View Details