Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix Metalloproteinase-2/MMP-2 (C-6His)

Source: Human Cells. MW :72.01kD. Recombinant Human Matrix Metalloproteinase-2 is produced by our Mammalian expression system and the target gene encoding Ala30-Cys660 is expressed with a 6His tag at the C-terminus. 72 kDa type IV collagenase also known as matrix metalloproteinase-2 (MMP-2) and gelatinase A is an enzyme that in humans is encoded by the MMP2 gene.It belongs to the matrix metalloproteinase (MMP) family. Matrix metalloproteinases (MMPs) are a family of zinc-dependent endopeptidases that degrade components of the extracellular matrix (ECM) and play essential roles in various physiological processes such as morphogenesis, differentiation, angiogenesis and tissue remodeling, as well as pathological processes including inflammation, arthritis, cardiovascular diseases, pulmonary diseases and tumor invasion. MMP-2 is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, atherosclerotic plaque rupture, as well as degrading extracellular matrix proteins. MMP-2 can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. MMP-2 cleaves KISS at a Gly-|-Leu bond and appears to have a role in myocardial cell death pathways.

Product Specifications

Gene Name

MMP2

Gene ID

4313

UniProt

P08253

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGCVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBGCP3 (Gamma-tubulin Complex Component 3, 104p, GCP3, Spc98, SPBC98, Spc98p, Grip104) (MaxLight 490)
MBS6441990-01 0.1 mL

TUBGCP3 (Gamma-tubulin Complex Component 3, 104p, GCP3, Spc98, SPBC98, Spc98p, Grip104) (MaxLight 490)

Sign In for Pricing
View Details
TUBGCP3 (Gamma-tubulin Complex Component 3, 104p, GCP3, Spc98, SPBC98, Spc98p, Grip104) (MaxLight 490)
MBS6441990-02 5x 0.1 mL

TUBGCP3 (Gamma-tubulin Complex Component 3, 104p, GCP3, Spc98, SPBC98, Spc98p, Grip104) (MaxLight 490)

Sign In for Pricing
View Details
PTP4A1 (NM_003463) Human Over-expression Lysate
LH06689V 100 µg

PTP4A1 (NM_003463) Human Over-expression Lysate

Sign In for Pricing
View Details
Poliovirus Receptor (PVR) (NM_001135768) Human Over-expression Lysate
LS005817-20ug 20 µg

Poliovirus Receptor (PVR) (NM_001135768) Human Over-expression Lysate

Sign In for Pricing
View Details
pBluescriptR-JPT1 Plasmid
PVT23207 2 µg

pBluescriptR-JPT1 Plasmid

Sign In for Pricing
View Details
UNC5C (NM_003728) Human Mass Spec Standard
PH324257 10 µg

UNC5C (NM_003728) Human Mass Spec Standard

Sign In for Pricing
View Details