Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix Metalloproteinase-1/MMP-1 (C-6His)

Source: Human Cells. MW :52.88kD. Recombinant Human Matrix Metalloproteinase-1 is produced by our Mammalian expression system and the target gene encoding Phe20-Asn469 is expressed with a 6His tag at the C-terminus. Matrix Metalloproteinase-1 (MMP-1) is expressed by fibroblasts, keratinocytes, endothelial cells, monocytes and macrophages. MMP1 contains several distinct domains: a prodomain that is cleaved upon activation, a catalytic domain containing the zinc binding site, a short hinge region, and a carboxyl terminal (hemopexin like) domain. MMP-1 can degrade a broad range of substrates including types I, II, III, VII, VIII, and X collagens as well as casein, gelatin, a1 antitrypsin, myelin basic protein, L-Selectin, pro-TNF, IL1, IGFBP3, IGFBP5, pro-MMP2, and pro-MMP9. A significant role of MMP1 is the degradation of fibrillar collagens in extracellular matrix remodeling, characterized by the cleavage of the interstitial collagen triple helix into 3/4, 1/4 fragments. MMP1 may also be involved in enzyme cascades, cytokine regulation and cell surface molecule modulation.

Product Specifications

Gene Name

MMP1

Gene ID

4312

UniProt

P03956

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 0.05% Brij35, pH 5.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKNVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Afmid (NM_027827) Mouse Tagged ORF Clone
MR204269 10 µg

Afmid (NM_027827) Mouse Tagged ORF Clone

Ask
View Details
Human Membrane Cofactor Protein ELISA Kit
MBS085314-01 48 Well

Human Membrane Cofactor Protein ELISA Kit

Ask
View Details
Human Membrane Cofactor Protein ELISA Kit
MBS085314-02 96 Well

Human Membrane Cofactor Protein ELISA Kit

Ask
View Details
Human Membrane Cofactor Protein ELISA Kit
MBS085314-03 5x 96 Well

Human Membrane Cofactor Protein ELISA Kit

Ask
View Details
Human Membrane Cofactor Protein ELISA Kit
MBS085314-04 10x 96 Well

Human Membrane Cofactor Protein ELISA Kit

Ask
View Details
Human Adenylyl Cyclase Associated Protein 1 (CAP1) ELISA Kit
MBS2703217-01 24 Strip Well

Human Adenylyl Cyclase Associated Protein 1 (CAP1) ELISA Kit

Ask
View Details