Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate-Specific Antigen//PSA/KLK3 (Ala18-Pro261, C-6His)

Source: Human Cells. MW :27.88kD. Recombinant Human Kallikrein 3 is produced by our Mammalian expression system and the target gene encoding Ala18-Pro261 is expressed with a 6His tag at the C-terminus. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen members of the Kallikrein subfamily located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.

Product Specifications

Gene Name

KLK3

Gene ID

354

UniProt

P07288

Components

Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 2mM CaCl2, pH 6.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Escherichia coli O157:H7 NRFC Polyclonal Antibody
MBS7163240 Inquire

Rabbit anti-Escherichia coli O157:H7 NRFC Polyclonal Antibody

Ask
View Details
ARH, CT (Low Density Lipoprotein Receptor Adapter Protein 1, Autosomal Recessive Hypercholesterolemia Protein, LDLRAP1) (MaxLight 490) discontinued
A3570-66B-ML490 100 µL

ARH, CT (Low Density Lipoprotein Receptor Adapter Protein 1, Autosomal Recessive Hypercholesterolemia Protein, LDLRAP1) (MaxLight 490) discontinued

Ask
View Details
Rat Emb  ELISA Kit
EF018628 96 Tests

Rat Emb ELISA Kit

Ask
View Details
3,3-Bis (4-methylthio) benzylpent-4-en-1-ol
426743-01 100 mg

3,3-Bis (4-methylthio) benzylpent-4-en-1-ol

Ask
View Details
3,3-Bis (4-methylthio) benzylpent-4-en-1-ol
426743-02 1 g

3,3-Bis (4-methylthio) benzylpent-4-en-1-ol

Ask
View Details
TXK Adenovirus (Human)
48860051 1.0 mL

TXK Adenovirus (Human)

Ask
View Details