Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 7/KLK7/SCEE (C-6His

Source: Human Cells. MW :26.17kD. Recombinant Human Kallikrein 7 is produced by our Mammalian expression system and the target gene encoding Glu23-His252 is expressed with a 6His tag at the C-terminus. Human Kallikrein 7 is a member of the tissue kallikrein family of extracellular serine proteases that is made up of 15 members. It is predominantly expressed in the skin. A major physiological function of Kallikrein 7 is to regulate the desquamation process (the shedding of corneocytes from the outer layer of the epidermis) through proteolysis of the intercellular adhesive structures between corneocytes. Dysregulation of Kallikrein 7 has been linked to several inflammatory skin diseases including atopic dermatitis, psoriasis, and Netherton syndrome. Studies have shown that Kallikrein 5 is a potential physiological activator for Kallikrein 7. The proform of Kallikrein 7 can be activated by thermolysin.

Product Specifications

Gene Name

KLK7

Gene ID

5650

UniProt

P49862

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPWGQPNDPGVYTQVCKFTKWINDTMKKHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HOXC12 (NM_173860) Human Recombinant Protein
TP761564 50 µg

HOXC12 (NM_173860) Human Recombinant Protein

Ask
View Details
MDH1
enz-256 5µg

MDH1

Ask
View Details
Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit
MBS040583-01 48 Well

Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit

Ask
View Details
Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit
MBS040583-02 96 Well

Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit

Ask
View Details
Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit
MBS040583-03 5x 96 Well

Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit

Ask
View Details
Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit
MBS040583-04 10x 96 Well

Sheep Cartilage Glycoprotein 39/Ykl40 ELISA Kit

Ask
View Details