Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 11/KLK11 (C-6His)

Source: Human Cells. MW :26.28kD. Recombinant Human Kallikrein 11 is produced by our Mammalian expression system and the target gene encoding Glu19-Asn250 is expressed with a 6His tag at the C-terminus. Human Kallikrein 11 (KLK11) is a member of tissue kallikrein family which are extracellular serine proteases consisting of 15 members. Two isoforms of KLK11 are differentially expressed. Isoform 1 is predominantly expressed in brain and isoform 2 is preferentially expressed in prostate. Isoform 1 consists of a signal peptide, a short pro peptide and the mature chain.Isoform 2 contains an extra 32 amino acid N terminal to full-length isoform 1.KLK11 is a novel marker for ovarian and prostate cancer carcinomas. KLK11 can be activated by thermolysin and is active against a thioester substrate.

Product Specifications

Gene Name

KLK11

Gene ID

11012

UniProt

Q9UBX7

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNNVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-LYPLA1 Antibody (R1F59)
RHB26501 100 μg

Anti-LYPLA1 Antibody (R1F59)

Ask
View Details
ROBO4 AAV Vector (Human) (CMV)
40674101 1 µg

ROBO4 AAV Vector (Human) (CMV)

Ask
View Details
Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)
MBS1260307-01 0.02 mg (E-Coli)

Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)

Ask
View Details
Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)
MBS1260307-02 0.1 mg (E-Coli)

Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)

Ask
View Details
Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)
MBS1260307-03 0.02 mg (Yeast)

Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)

Ask
View Details
Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)
MBS1260307-04 0.1 mg (Yeast)

Recombinant Hyperthermus butylicus Nucleoside diphosphate kinase (ndk)

Ask
View Details