Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 10/KLK10 (C-6His)

Source: Human Cells. MW :27.98kD. Recombinant Human Kallikrein 10 is produced by our Mammalian expression system and the target gene encoding Ala31-Asn276 is expressed with a 6His tag at the C-terminus. Kallikreins are a subgroup of Serine Proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen Kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.

Product Specifications

Gene Name

KLK10

Gene ID

5655

UniProt

O43240

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSNVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bromo-PEG3-t-butyl ester
572171 250.0mg

Bromo-PEG3-t-butyl ester

Ask
View Details
Recombinant Archimandrita tessellata Hypertrehalosaemic factor
MBS1164234-01 0.05 mg (E-Coli)

Recombinant Archimandrita tessellata Hypertrehalosaemic factor

Ask
View Details
Recombinant Archimandrita tessellata Hypertrehalosaemic factor
MBS1164234-02 0.2 mg (E-Coli)

Recombinant Archimandrita tessellata Hypertrehalosaemic factor

Ask
View Details
Recombinant Archimandrita tessellata Hypertrehalosaemic factor
MBS1164234-03 0.5 mg (E-Coli)

Recombinant Archimandrita tessellata Hypertrehalosaemic factor

Ask
View Details
Recombinant Archimandrita tessellata Hypertrehalosaemic factor
MBS1164234-04 0.05 mg (Yeast)

Recombinant Archimandrita tessellata Hypertrehalosaemic factor

Ask
View Details
Recombinant Archimandrita tessellata Hypertrehalosaemic factor
MBS1164234-05 0.05 mg (Baculovirus)

Recombinant Archimandrita tessellata Hypertrehalosaemic factor

Ask
View Details