Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High Mobility Group Protein B1/HMGB1 (C-6His)

Source: Human Cells. MW :25.93kD. Recombinant Human High Mobility Group Protein B1 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu215 is expressed with a 6His tag at the C-terminus. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.

Product Specifications

Gene Name

HMGB1

Gene ID

3146

UniProt

P09429

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDEVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Ghrelin/Obestatin Antibody
NBP1-89773-25ul 25 µL

Rabbit Polyclonal Ghrelin/Obestatin Antibody

Ask
View Details
Kallikrein 5 Antibody
V8212SAF-100UG 100 µg

Kallikrein 5 Antibody

Ask
View Details
Von Willebrand Factor Polyclonal Antibody APC Conjugated
MBS9462397-01 0.1 mL

Von Willebrand Factor Polyclonal Antibody APC Conjugated

Ask
View Details
Von Willebrand Factor Polyclonal Antibody APC Conjugated
MBS9462397-02 5x 0.1 mL

Von Willebrand Factor Polyclonal Antibody APC Conjugated

Ask
View Details
CITED2 Antibody
MBS153523-01 0.1 mg

CITED2 Antibody

Ask
View Details
CITED2 Antibody
MBS153523-02 5x 0.1 mg

CITED2 Antibody

Ask
View Details