Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human N-Acetylglucosamine-6-Sulfatase/GNS (C-6His)

Source: Human Cells. MW :59.35kD. Recombinant Human N-Acetylglucosamine-6-Sulfatase is produced by our Mammalian expression system and the target gene encoding Val37-Leu552 is expressed with a 6His tag at the C-terminus. N-Acetylglucosamine-6-Sulfatase is a member of the Sulfatase family. N-Acetylglucosamine-6-Sulfatase is required for the lysosomal degradation of the Glycosaminoglycans (GAG) Heparan Sulfate and Keratan Sulfate. N-Acetylglucosamine-6-Sulfatase hydrolyzes the 6-Sulfate groups of the N-Acetyl-D-Glucosamine 6-Sulfate units of Heparan Sulfate and Keratan Sulfate. N-Acetylglucosamine-6-Sulfatase binds 1 Calcium ion per subunit. N-Acetylglucosamine-6-Sulfatase deficiency are the cause of Mucopolysaccharidosis Type 3D (MPS3D), an inborn error leading to lysosomal accumulation of heparan sulfate. MPS3D has profound mental deterioration, hyperactivity, and relatively mild somatic manifestations.

Product Specifications

Gene Name

GNS

Gene ID

2799

UniProt

P15586

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl,10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLLVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Rtf1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4519802 1.0 µg DNA

Rtf1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Phospho-NCF2 (Thr233) Peptide
AF4343-BP 1 mg

Phospho-NCF2 (Thr233) Peptide

Sign In for Pricing
View Details
AKR1B1 (Aldo-keto Reductase Family 1 Member B1, ADR, ALDR1, ALR2, AR, MGC1804) (HRP)
MBS6406007-01 0.1 mL

AKR1B1 (Aldo-keto Reductase Family 1 Member B1, ADR, ALDR1, ALR2, AR, MGC1804) (HRP)

Sign In for Pricing
View Details
AKR1B1 (Aldo-keto Reductase Family 1 Member B1, ADR, ALDR1, ALR2, AR, MGC1804) (HRP)
MBS6406007-02 5x 0.1 mL

AKR1B1 (Aldo-keto Reductase Family 1 Member B1, ADR, ALDR1, ALR2, AR, MGC1804) (HRP)

Sign In for Pricing
View Details
SOX2 Antibody
MBS7130456-01 0.1 mL

SOX2 Antibody

Sign In for Pricing
View Details
SOX2 Antibody
MBS7130456-02 5x 0.1 mL

SOX2 Antibody

Sign In for Pricing
View Details