Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM3D (C-6His)

Source: Human Cells. MW :23.12kD. Recombinant Human Protein FAM3D is produced by our Mammalian expression system and the target gene encoding Tyr26-Phe224 is expressed with a 6His tag at the C-terminus. Protein FAM3D is a novel cytokine-like protein that belongs to the FAM3 family. Human FAM3D is synthesized as a 224 amino acid precursor that contains a 25 amino acid signal sequence and a 199 amino acid mature chain. FAM3D is identified based on structural, but not sequence, homology to short chain cytokines including IL-2, IL-4 and GM-CSF. FAM3 proteins are four helix bundle cytokines with four conserved cysteines in all members (FAM3A-D) . FAM3B is highly expressed in alpha and beta cells of the pancreas and is being investigated as a potential contributor to beta cell death and development of Type I Diabetes.

Product Specifications

Gene Name

FAM3D

Gene ID

131177

UniProt

Q96BQ1

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UGT2A3 Antibody; Biotin conjugated
MBS7003472-01 0.05 mg

UGT2A3 Antibody; Biotin conjugated

Ask
View Details
UGT2A3 Antibody; Biotin conjugated
MBS7003472-02 0.1 mg

UGT2A3 Antibody; Biotin conjugated

Ask
View Details
UGT2A3 Antibody; Biotin conjugated
MBS7003472-03 5x 0.1 mg

UGT2A3 Antibody; Biotin conjugated

Ask
View Details
iVDye 1Kb DNA Ladder
V1003-050 50 µL

iVDye 1Kb DNA Ladder

Ask
View Details
RPS6KB2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
42599154 3x 1.0 µg DNA

RPS6KB2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Ask
View Details
Usp11 Rat Pre-designed siRNA Set A
HY-RS23883 1 Set

Usp11 Rat Pre-designed siRNA Set A

Ask
View Details