Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelial Cell Adhesion Molecule/ESAM (C-6His)

Source: Human Cells. MW :24.79kD. Recombinant Human ESAM is produced by our Mammalian expression system and the target gene encoding Gln30-Ala247 is expressed with a 6His tag at the C-terminus. Endothelial Cell Adhesion Molecule (ESAM) is a 55 kDa type I transmembrane glycoprotein member of the JAM family of immunoglobulin superfamily molecules. The 390 amino acid Human ESAM contains a 216 amino acid extracellular domain (ECD) with a V-type and a C2-type immunoglobulin (Ig) domain. ESAM is specifically expressed at endothelial tight junctions and on activated platelets and performs homophilic adhesion activity. The adaptor protein membrane-associated guanylate kinase MAGI-1 has been identified as an intracellular binding partner of ESAM. In addition, ESAM at endothelial tight junctions participates in the migration of neutrophils through the vessel wall, possibly by influencing endothelial cell contacts. ESAM-deficient mice were described with lowered angiogenic potential, and accordingly, overexpression of ESAM is closely associated with certain tumor growth and metastasis. ESAM is expressed on endothelial cells, activated platelets and megakaryocytes. The ECD of human and mouse ESAM share 69% amino acid identity.

Product Specifications

Gene Name

ESAM

Gene ID

90952

UniProt

Q96AP7

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human AIP Recombinant Protein
PPT-10464 100 µg

Human AIP Recombinant Protein

Ask
View Details
PRDM11 (NM_020229) Human Tagged Lenti ORF Clone
RC222911L4 10 µg

PRDM11 (NM_020229) Human Tagged Lenti ORF Clone

Ask
View Details
ZBTB7B (Zinc Finger and BTB Domain Containing 7B, DKFZp686G01254, THPOK, ZBTB15, ZFP67, ZNF857B, c-Krox, hcKrox) (PE)
253560-PE 100 µL

ZBTB7B (Zinc Finger and BTB Domain Containing 7B, DKFZp686G01254, THPOK, ZBTB15, ZFP67, ZNF857B, c-Krox, hcKrox) (PE)

Ask
View Details
Mettl21e Mouse shRNA Plasmid (Locus ID 403183)
TL510362 1 Kit

Mettl21e Mouse shRNA Plasmid (Locus ID 403183)

Ask
View Details