Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human EpCAM/TROP1/CD326 (C-6His)

Source: Human Cells. MW :28.43kD. Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed with a 6His tag at the C-terminus. Epithelial Cell Adhesion Molecule (EpCAM) is a signal type I transmembrane glycoprotein that belongs to the EPCAM family. EpCAM is composed of an extracellular domain with one thyroglobulin type-1 domain, a transmembrane domain and a cytoplasmic domain. EpCAM is found on the surface of adenocarcinoma, but not on mesodermal or neural cell membranes. The EpCAM molecule has been shown to function as a homophilic Ca2+ independent adhesion molecule. It may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium as an immunological barrier providing the first line of defense against infection. Defects in EPCAM are a cause of hereditary non-polyposis colorectal cancer type 8 (HNPCC8) and diarrhea type 5 (DIAR5) . EpCAM plays a role in embryonic stem cells proliferation and differentiation; it up-regulates the expression of FABP5, MYC and Cyclin A and Cyclin E. It is highly and selectively expressed by undifferentiated embryonic stem cells.

Product Specifications

Gene Name

EPCAM

Gene ID

4072

UniProt

P16422

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

5930416I19Rik (BC027368) Mouse Untagged Clone
MC218447 10 µg

5930416I19Rik (BC027368) Mouse Untagged Clone

Ask
View Details
Rabbit anti-Shigella flexneri glnS Polyclonal Antibody
MBS7199630 Inquire

Rabbit anti-Shigella flexneri glnS Polyclonal Antibody

Ask
View Details
DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (MaxLight 490) discontinued
034813-ML490 100 µL

DSCR1L1, NT (RCAN2, DSCR1L1, ZAKI4, Calcipressin-2, Down syndrome candidate region 1-like 1, Myocyte-enriched calcineurin-interacting protein 2, Regulator of calcineurin 2, Thyroid hormone-responsive protein ZAKI-4) (MaxLight 490) discontinued

Ask
View Details
Icosabutate
MF-0015949-01 1 mg

Icosabutate

Ask
View Details
Icosabutate
MF-0015949-02 2 mg

Icosabutate

Ask
View Details
Icosabutate
MF-0015949-03 5 mg

Icosabutate

Ask
View Details