Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin F/CST7 (C-6His)

Source: Human Cells. MW :15.58kD. Recombinant Human Cystatin F is produced by our Mammalian expression system and the target gene encoding Gly20-His145 is expressed with a 6His tag at the C-terminus. CST7 is a secreted protein and primarily expressed in peripheral blood cells and spleen.It is belongs to the cystatin family. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. This gene encodes a glycosylated cysteine protease inhibitor with a putative role in immune regulation through inhibition of a unique target in the hematopoietic system.

Product Specifications

Gene Name

CST7

Gene ID

8530

UniProt

O76096

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCHVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Troponin I Type 2, Fast Skeletal (TNNI2) BioAssayTM ELISA Kit (Rat)
028627 96 Tests

Troponin I Type 2, Fast Skeletal (TNNI2) BioAssayTM ELISA Kit (Rat)

Ask
View Details
Rabbit Polyclonal Kallikrein 5 Antibody [DyLight 350]
NB200-138UV 0.1 mL

Rabbit Polyclonal Kallikrein 5 Antibody [DyLight 350]

Ask
View Details
Snx6 ORF Vector (Rat) (pORF)
45086016 1.0 µg DNA

Snx6 ORF Vector (Rat) (pORF)

Ask
View Details
Rabbit Anti-Mouse FK506 Binding Protein 3 (FKBP3) Polyclonal Antibody
VD2N913 1 Each

Rabbit Anti-Mouse FK506 Binding Protein 3 (FKBP3) Polyclonal Antibody

Ask
View Details
Mouse anti-BRD2 Monoclonal Antibody, Affinity Purified [12C2E4]
A500-014A-T 20 µL (2 Blots)

Mouse anti-BRD2 Monoclonal Antibody, Affinity Purified [12C2E4]

Ask
View Details