Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin M/CST6 (C-6His)

Source: Human Cells. MW :14.66kD. Recombinant Human Cystatin E/M is produced by our Mammalian expression system and the target gene encoding Arg29-Met149 is expressed with a 6His tag at the C-terminus. Cystatin-M is a typical secretory protein. It is synthesized as a preprotein with a patent N-terminal signal sequence.It belongs to the cystatin family. The most widely accepted function of cystatins is that of protease inhibitors. Most cysteine proteases are confined within cells where optimal pH and redox conditions favor their enzymatic activity. Thus, the majority of intracellular cysteine proteases are inactivated by oxidizing conditions outside the cells. Among the various types of intracellular cysteine proteases, cystatins seem to target preferentially endosomal/lysosomal cysteine proteases of the papain family, such as cathepsin B, cathepsin K/O2, cathepsin L, cathepsin L2/V and cathepsin S. Another important function of Cst6 seems to be in the terminal differentiation of stratified squamous epithelial cells and in the formation of cornified envelops. Cst6 is believed to be important in fine-tuning the enzymatic activities of endosomal/lysosomal cysteine proteases such as cathepsin L, cathepsin L2/V and AEP/mammalian legumain. Deregulated activity of these proteases could lead to abnormal activation of transglutaminases and disorders in cornification.

Product Specifications

Gene Name

CST6

Gene ID

1474

UniProt

Q15828

Components

Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQMLEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Factor VIII Antibody
NBP3-00213-100ul 100 µL

Rabbit Polyclonal Factor VIII Antibody

Ask
View Details
Human CDNF Recombinant Protein C-6His Tag Lyophilized
MBS8431635 Inquire

Human CDNF Recombinant Protein C-6His Tag Lyophilized

Ask
View Details
Anti-NF-M/NEFM Antibody, Rabbit Polyclonal
MBS8103757-01 0.1 mL

Anti-NF-M/NEFM Antibody, Rabbit Polyclonal

Ask
View Details
Anti-NF-M/NEFM Antibody, Rabbit Polyclonal
MBS8103757-02 5x 0.1 mL

Anti-NF-M/NEFM Antibody, Rabbit Polyclonal

Ask
View Details
SERPINB4 Monoclonal Antibody, Cy5.5 Conjugated
bsm-43150M-Cy5.5 100 µL

SERPINB4 Monoclonal Antibody, Cy5.5 Conjugated

Ask
View Details
AHSA1 Rabbit Monoclonal Antibody [KD Validation]
E51K1574 40 µL

AHSA1 Rabbit Monoclonal Antibody [KD Validation]

Ask
View Details