Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TRAIL R2/TNFRSF10B/DR5/CD262 (C-6His)

Source: Human Cells. MW :15.19kD. Recombinant Human TRAIL receptor 2 is produced by our Mammalian expression system and the target gene encoding Ile56-Glu182 is expressed with a 6His tag at the C-terminus. TNFRSF10B is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces apoptosis signal. The adapter molecule FADD recruits caspase-8 to the activated receptor and is required for the apoptosis mediated by TNFRSF10B. TNFRSF10B is expressed in a number of cell types, and to particularly high levels in lymphocytes and spleen. This single-pass transmembrane protein contains two cysteine-rich repeat units in its extracellular region, followed by a transmembrane segment and a cytoplasmic tail containing a typical “death domain”. TNFRSF10B expression is regulated by the tumor suppressor p53. It is also indicated that the activation of NF-kappa-B can be promoted by TNFRSF10B.

Product Specifications

Gene Name

TNFRSF10B

Gene ID

8795

UniProt

O14763

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKEVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LTC4S Overexpression Lysate (Native) - (Dry Ice)
NBL1-12741 0.1 mg

LTC4S Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
ENSA Polyclonal Antibody
RD88277A-01 60 μL

ENSA Polyclonal Antibody

Ask
View Details
ENSA Polyclonal Antibody
RD88277A-02 120 μL

ENSA Polyclonal Antibody

Ask
View Details
ENSA Polyclonal Antibody
RD88277A-03 200 µL

ENSA Polyclonal Antibody

Ask
View Details
Human MAPK11 qPCR Primer Pair
QH05037S 200 Tests

Human MAPK11 qPCR Primer Pair

Ask
View Details
APPL2, NT (APPL2, DIP13B, DCC-interacting protein 13-beta, Adapter protein containing PH domain, PTB domain and leucine zipper motif 2) (FITC) discontinued
032000-FITC 200 µL

APPL2, NT (APPL2, DIP13B, DCC-interacting protein 13-beta, Adapter protein containing PH domain, PTB domain and leucine zipper motif 2) (FITC) discontinued

Ask
View Details