Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD55/DAF (C-6His)

Source: Human Cells. MW :36kD. Recombinant Human CD55 is produced by our Mammalian expression system and the target gene encoding Asp35-Ser353 is expressed with a 6His tag at the C-terminus. CD55 is a member of the RCA (regulators of complement activation) family. RCA proteins is characterized by the presence of four to 30 SCRs (short consensus repeats also called CCPs for control protein modules) in their plasmaexposed regions. CD55 containing four SCR modules is involved in the regulation of the complement cascade. CD55 is known to bind CD97 via the first SCR. It also binds physiologically generated C3 convertases with its second and third SCRs. Binding results in an accelerated “decay”, or dissociation of active C3 convertases, thus blocking the development of Câ€TM attack complexes on nonforeign cells. It is known that viruses and bacteria also utilize multiple SCR sites for infection.

Product Specifications

Gene Name

CD55

Gene ID

1604

UniProt

P08174

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Septin-1 Antibody [Biotin]
NBP2-81892B 0.1 mL

Rabbit Polyclonal Septin-1 Antibody [Biotin]

Sign In for Pricing
View Details
TMCO5A Polyclonal Antibody, Biotin Conjugated
A61343-100 100 µL

TMCO5A Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal RABL2A Antibody (OTI4A3) [CoraFluor 1]
NBP2-73777CL1 0.1 mL

Mouse Monoclonal RABL2A Antibody (OTI4A3) [CoraFluor 1]

Sign In for Pricing
View Details
Recombinant CDX2 Antibody
V3964SAF-100UG 100 µg

Recombinant CDX2 Antibody

Sign In for Pricing
View Details
Fenbutatin oxide (Standard)
HY-133004R 1 Each

Fenbutatin oxide (Standard)

Sign In for Pricing
View Details
(6b,17a)-19-Norpregna-1,3,5(10)-trien-20-yne-6,17-diol 6-(4-Nitrobenozoate)
TRC-N825090-10MG 10 mg

(6b,17a)-19-Norpregna-1,3,5(10)-trien-20-yne-6,17-diol 6-(4-Nitrobenozoate)

Sign In for Pricing
View Details