Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Intercellular Adhesion Molecule 1/ICAM-1/CD54 (C-6His)

Source: Human Cells. MW :50.54kD. Recombinant Human Intercellular Adhesion Molecule 1 is produced by our Mammalian expression system and the target gene encoding Gln28-Glu480 is expressed with a 6His tag at the C-terminus. Inter-Cellular Adhesion Molecule 1 (ICAM1) is a type of intercellular adhesion molecule continuously present in low concentrations in the membranes of leukocytes and endothelial cells. As an endothelial and leukocyte-associated transmembrane protein, ICAM1 is well known for its importance in stabilizing cell-cell interactions and facilitating leukocyte endothelial transmigration. The presence of heavy glycosylation and other structural characteristics lend ICAM1 binding sites for a number of immune-associated ligands. Notably, ICAM-1 binds to macrophage adhesion ligand-1 (Mac-1; ITGB2 / ITGAM), leukocyte function associated antigen-1 (LFA-1/integrin), and fibrinogen.ICAM-1 expressed by respiratory epithelial cells is also the binding site for rhinovirus, the causative agent of most common colds.

Product Specifications

Gene Name

ICAM1

Gene ID

3383

UniProt

P05362

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Avermectin B1 10mM * 1mL in DMSO
A12539-10mM-D 10 mM x 1mL in DMSO

Avermectin B1 10mM * 1mL in DMSO

Ask
View Details
GENLISA™ Human Microtubule Associated Serine/Threonine Kinase 2 (MAST2) ELISA
KBH21531 1x 96 Well

GENLISA™ Human Microtubule Associated Serine/Threonine Kinase 2 (MAST2) ELISA

Ask
View Details
CRYZ (Quinone Oxidoreductase, NADPH:Quinone Reductase, Zeta-crystallin) (MaxLight 650)
MBS6374816-01 0.1 mL

CRYZ (Quinone Oxidoreductase, NADPH:Quinone Reductase, Zeta-crystallin) (MaxLight 650)

Ask
View Details
CRYZ (Quinone Oxidoreductase, NADPH:Quinone Reductase, Zeta-crystallin) (MaxLight 650)
MBS6374816-02 5x 0.1 mL

CRYZ (Quinone Oxidoreductase, NADPH:Quinone Reductase, Zeta-crystallin) (MaxLight 650)

Ask
View Details
SH3PX1 (SNX9) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA501356 100 µL

SH3PX1 (SNX9) Mouse Monoclonal Antibody [Clone ID: OTI2G4]

Ask
View Details
Rat BMP6 siRNA
abx909178-01 15 nmol

Rat BMP6 siRNA

Ask
View Details