Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD47/IAP/OA3 (C-6His)

Source: Human Cells. MW :14.76kD. Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a 6His tag at the C-terminus. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Product Specifications

Gene Name

CD47

Gene ID

961

UniProt

Q08722

Components

Lyophilized from a 0.2 μm filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MIRacle™ mmu-miR-350-5p miRNA Agomir/Antagomir
AM3541 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-350-5p miRNA Agomir/Antagomir

Ask
View Details
Recombinant Human MED7 Protein, N-His
YHA69401 100 μg

Recombinant Human MED7 Protein, N-His

Ask
View Details
GAL4 (Galectin 4) Monkey ELISA Kit
D5768 96 Tests

GAL4 (Galectin 4) Monkey ELISA Kit

Ask
View Details
LRRC63 siRNA (Human)
MBS8230278-01 15 nmol

LRRC63 siRNA (Human)

Ask
View Details
LRRC63 siRNA (Human)
MBS8230278-02 30 nmol

LRRC63 siRNA (Human)

Ask
View Details
LRRC63 siRNA (Human)
MBS8230278-03 5x 30 nmol

LRRC63 siRNA (Human)

Ask
View Details