Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fc gamma RIIa/FCGR2A/CD32a (C-6His)

Source: Human Cells. MW :21.61kD. Recombinant Human Fc gamma RIIa is produced by our Mammalian expression system and the target gene encoding Ala36-Ile218 is expressed with a 6His tag at the C-terminus. Receptors for the Fc region of IgG (Fc gamma R) are members of the Ig superfamily that function in the activation or inhibition of immune responses. Human Fc gamma Rs are divided into three classes designated Fc gamma RI (CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16), which generate multiple isoforms, are recognized. The activating­ type receptor either has or associates non­covalently with an accessory subunit that has an immunoreceptor tyrosine­based activation motif (ITAM) in its cytoplasmic domain. Fc gamma RI binds IgG with high affinity and functions during early immune responses, whereas Fc gamma RII and RIII are low affinity receptors that recognize IgG as aggregates surrounding multivalent antigens during late immune responses. Three genes for human Fc gamma RII (A, B, and C) and one for mouse (Fc gamma RIIB), encoding type I transmembrane proteins with ITAM motifs (Fc gamma RII A and C) or ITIM motifs (Fc gamma RIIB) in their cytoplasmic domains, have been identified. Human CD32, also known as Low affinity immunoglobulin gamma Fc region receptor II-a (IgG Fc receptor II-a), Fc gamma RII A or FCGR2A Protein, is expressed on cells of both myeloid and lymphoid lineages as well as on cells of non-hematopoietic origin. Associated with an ITAM-bearing adapter subunit, FcR gamma , CD32a (Fc gamma RII A) delivers an activating signal upon ligand binding, and results in the initiation of inflammatory responses including cytolysis, phagocytosis, degranulation, and cytokine production. The responses can be modulated by signals from the co-expressed inhibitory receptors such as Fc gamma RII B, and the strength of the signal is dependent on the ratio of expression of the activating and inhibitory receptors.

Product Specifications

Gene Name

FCGR2A

Gene ID

2212

UniProt

P12318

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit
MBS8801242-01 48 Well

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit

Sign In for Pricing
View Details
Human FOXP3 (Forkhead Box Protein P3) ELISA Kit
MBS8801242-02 96 Well

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit

Sign In for Pricing
View Details
Human FOXP3 (Forkhead Box Protein P3) ELISA Kit
MBS8801242-03 5x 96 Well

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit

Sign In for Pricing
View Details
Human FOXP3 (Forkhead Box Protein P3) ELISA Kit
MBS8801242-04 10x 96 Well

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit

Sign In for Pricing
View Details
Human FABP9 (NM_001080526) AAV Particle
RC215816A1V 250 µL

Human FABP9 (NM_001080526) AAV Particle

Sign In for Pricing
View Details
Slc5a2 3'UTR GFP Stable Cell Line
TU270701 1.0 mL

Slc5a2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details